LL-37 COA Guide – How to Evaluate Research Product Documentation

Researchers searching for an LL-37 COA are usually trying to answer a straightforward procurement question:

What analytical evidence supports this LL-37 research product?

A Certificate of Analysis can provide valuable information.

However, the existence of a COA shouldn’t automatically be interpreted as proof that every important product characteristic has been independently established.

Researchers should examine what the certificate actually reports.

What Is an LL-37 COA?

A Certificate of Analysis is a document reporting product specifications or analytical results associated with a sample, product, or batch.

Depending on the document, an LL-37 COA may include:

• Product name
• Compound identification
• Batch/lot
• Purity
• Analytical method
• Identity-related information
• Test date
• Additional specifications

The exact fields can vary.

Start With Compound Identity

Before looking at the purity percentage, verify which compound the COA identifies.

The intended material should be:

LL-37

The peptide contains 37 amino-acid residues.

Its sequence is:

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Distinguish LL-37 From hCAP18

A COA should correspond to the actual research material.

LL-37 is derived from hCAP18, but the terms shouldn’t be treated as identical molecular product names.

If the product is sold as LL-37, the analytical documentation should correspond to LL-37.

Check the Batch Number

Look for:

batch

or

lot

information.

Researchers should determine whether the certificate corresponds to the material being purchased.

A COA from an earlier batch shouldn’t automatically be assumed to characterize later inventory.

Check the Analytical Method

A purity result becomes more meaningful when researchers understand how it was generated.

One commonly encountered method is:

HPLC — High-Performance Liquid Chromatography

The COA may also contain or reference identity-related analytical testing.

Understand the Purity Result

If the certificate reports a percentage, determine what that percentage represents.

Ask:

• Is it chromatographic purity?
• Which method produced it?
• Which sample was analyzed?
• Which batch does it represent?

Avoid interpreting the number outside its analytical context.

Purity Isn’t Complete Identity Verification

A chromatographic purity result can provide useful information about sample composition.

However, it doesn’t automatically establish every aspect of molecular identity.

Researchers should review available identity-related testing separately.

Check Supporting Analytical Information

Where available, researchers may want to review:

• Chromatographic information
• Identity-related analytical data
• Batch information
• Additional test records

The COA may be a summary of these results rather than the entirety of the analytical evidence.

Match the COA to the Product

Researchers can review current LL-37 products here:

https://peptideslabus.com/products?q=LL-37

For the 5mg listing:

https://peptideslabus.com/products/ll-37-5mg-research-peptide

Additional listings:

https://peptideslabus.com/products/crown-ll-37-research-peptide

https://peptideslabus.com/products/peptides-lab-ll37

Documentation should be evaluated in relation to the specific product under consideration.

COA vs Product Page

A product page may provide:

• Product name
• Quantity
• Price
• Availability
• General specifications

A COA may provide analytical results associated with the product or batch.

Researchers should use both where appropriate.

Don’t Judge a COA by Design

A polished certificate isn’t automatically analytically stronger.

Focus on:

What was tested?

Which method was used?

What result was obtained?

Which batch does it describe?

These questions are more important than graphic presentation.

LL-37 COA Evaluation Checklist

Before relying on a certificate:

1. Confirm the compound is LL-37.
2. Review sequence/identity information.
3. Check the batch or lot.
4. Identify the analytical method.
5. Review the reported purity.
6. Determine what the percentage represents.
7. Review identity-related testing.
8. Look for supporting analytical information.
9. Match the COA to the relevant product.
10. Avoid assuming one historical COA applies to every batch.

Browse Current LL-37 Research Products

https://peptideslabus.com/products?q=LL-37

An LL-37 COA is most useful when researchers evaluate its compound identity, analytical methods, results, and batch relationship rather than simply checking whether a certificate exists.

For laboratory research purposes only.